- Recombinant Coxiella burnetii UPF0434 protein CbuG_1535 (CbuG_1535)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1155833
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 6,542 Da
- E Coli or Yeast
- 20455
- UPF0434 protein CbuG_1535 (CbuG_1535)
Sequence
MDRRLLEILACPICKGKLVYSQDEQELICRFDKLVYPIHDGIPVMLPDSTRPLIER